⚡ This is your brand? Claim your page FREE and bring it to life on AI search.

AI Visibility Scorecard

Home

Home

Unclaimed

freemarketphysicianscassville.com · Healthcare

At 2.8/10, Home is close to invisible in AI search today. Most assistants will not cite it when asked about your category - fixable, and the signals below show exactly where to start.

AI engines read this profile 1 times

Claude

#664,315 of 699,089 in Healthcare for AI visibility

2.8

/10

AEO Score

Share

About Home

from our crawl and measurement

Home is a business whose own site puts it this way: "Dr. Lyman Wostrel, MD and Dr. Lauren Wostrel, MD are your free-thinking, farming, free market doctors who actually care about you as a whole person." As far as answer engines are concerned it may as well not exist yet: 2.8 out of 10.

On the page it is passable on a workable page structure and basic crawler access. What holds it back is a clearly stated business identity, credibility markers like credentials or reviews, sitemaps and entity links AI can follow and structured data describing the business.

Off the page there is only faint evidence that only a handful of sites link to it. Beyond that, the domain does not yet read as established, AI engines do not yet recognise it as a distinct business, there is no press coverage to draw on, nobody is discussing it where AI engines look and it does not come up on Reddit. None of that can be fixed on the page: it has to be earned.

AI crawlers have visited once in our tracking, including ClaudeBot (Anthropic). The site links to no social profiles, so there is nothing tying the brand to a wider presence.

Industry · Healthcare
Last scored · Jul 30, 2026

The 6 signals AI reads

Higher is better · 0-10

Structured Data

1

Organization / LocalBusiness JSON-LD that AI can read.

Content Structure

5

Clear headings and answer-style content.

Entity Clarity

3

How clearly your brand identity reads to AI.

E-E-A-T Signals

Experience, Expertise, Authority, Trust

4

Experience, Expertise, Authority, Trust markers.

Technical AEO

5

robots.txt, llms.txt, and AI-bot crawl access.

AI Discoverability

4

Sitemaps and entity links AI can follow.

Off-page authority

How the web signals your brand to AI

Backlinks

1

Inbound links from other sites.

Domain Trust

0

Little domain authority yet.

Entity Presence

0

Not in AI knowledge graphs yet.

News Mentions

0

No press coverage found yet.

Community

0

No community discussion yet.

Reddit

0

No Reddit mentions found yet.

What this score means

Your AEO score measures whether AI search engines - ChatGPT, Claude, Perplexity, Gemini - can actually read your site and cite it in answers. Roughly two-thirds of sites are invisible to them. At 2.8/10, Home is crawlable but under-signaled - fixable, and the signals above are where to start.

Is this your brand?

The exact fixes for Home

Which AI engines already crawl you

Weekly ChatGPT & Claude citation tracking

Already have an account? Sign in

Picked for Home: Health & Wellness

Trust Is the Product. AI Is How You Build It at Scale.

In health and wellness, you're not just selling a product. You're asking someone to trust you with their body.

Continue reading in your free Engagemii portal

Free signup unlocks the full article plus your personalized AEO fix list for Home.

Source & Attribution

Scored by Engagemii on July 30, 2026. Methodology: engagemii.com/aeo/methodology

Source URL: https://engagemii.com/aeo/brands/freemarketphysicianscassville

Cite this score: Engagemii (2026). "AEO Score for Home." Retrieved from https://engagemii.com/aeo/brands/freemarketphysicianscassville

Licensed under CC BY 4.0. You may reuse this data with attribution: a visible link to engagemii.com.

Powered by Engagemii - The Answer Engine Optimization (AEO) Platform